Postings from July 1-15, 2001

 

Date: July 15, 2001

Hi Happy,

Hope all has been going well for you.  It has been a while since I last posted.  I have been going to the doctor since April.  I am on meds for high blood pressure and depression/stress.  It really isn't doing much for my OCD rules!  They still must be followed, but my chest is not all tight and everything does not set me off now.

 My son is in the hospital (very good facility) he has been diagnosed with bipolar disorder and they are teaching him how to deal with that.  I am not sure when he will be coming home.  We have a meeting with staff on the 20th.  I want for him to come home and live with me, he talks about that also, but then after talking with the grandparents he said they suggest he lives with them.  I told him he has under two years to be with me and then he could go with them.  It is very frustrating!  I want for him to be independent and I feel like my mom babies him.  How should I handle this. 

It is getting to the point where my mom and I hardly ever talk.  She is putting a lot of stress on mine and her relationship.  Myself and my siblings always felt she loved our older brother more than us and now again with my son.

I want him to come home, get a job and go to school, she wants him to come home, buy him a car, he works for her and lives under her wing.  They will not be around forever and he needs the skills to live his life.

Any advise will be greatly appreciated!

ocdnet(tryingtodotherightthing)angel

Dear ocdnetangel,

Your mother is overstepping her boundaries as she has in the past. Your parents idea of having your son come and live with them in the past did not result in his getting any better. There denial that he suffers from a serious mental illness sabotages the efforts of the hospital to teach him how to deal with his condition. His living with them now will only serve to hamper his maturing into a self sufficient adult with insight into his condition. 

The problem though, is how far you are willing to go in order to assert your parental rights? Are you willing to have your parents banned from hospital visits and contact with your son while he's there? You do feel you have the right to demand this. If they are driving a wedge between you and your son, then I would strongly suggest you raise that as an option at the staff meeting with the clinicians in the hospital.

No matter how much you mother may "love" your son, she is not his legal guardian. You say you hardly speak to her anymore however, you need to do so. You need to remind her that you will decide where your son lives while he is a minor and she must respect your wishes. The courts have upheld that grandparents do not have parental rights as long as there is a parent who does is competent. Don't let your parents bully you ocdnetangel. Let them know that if they want a relationship with their grandson, they must respect your rights and wishes as his parent. Don't settle for less. It will be to your son's detriment if you do. Please let me know what happens.

happy(doesn'tsettleforlesseither)shrink 

 

Dear Happy,

You are always so right. I shudda called Edna bout the swimmin' rat, but I goofed. But this brings up a nother sitchiation. When My Earl come home, him beein' a NRA gun lovin' Republican, he just shot the thing with a oozy. (ruint my bucket though) But what's got me worried is bout the future o' my youngin, Harley Dono. Ten year ago, I poisond a rat, an it whent outside ta die. In 3 ours aftern I found it, the ants had peelt the skin an' fur back an' was a swarmin' an' eatin it up, an' it be a biggun too. By suppertime, all that were left be the tale. This time, this beein a little rat, it takin over 2 days fer them ants ta eat it down ta the tale.

Now Bush W, beein' one o' our own, sayed they aint no problims with our country, but, I'mma askin', do you think small rats an' lazy ants is cuzzin' o' Global Warming (I mita spelt that wrong)?

Gind Rinker

Dear Gind,

It might relieve you to know that the rats up here in the North are just as big as ever. In fact, some of them look just like people. They must agree with President Bush that there is nothing wrong with our country.

happy(feelingwarmandglobalinside)shrink

 

Date: July 14, 2001

Dear Happy,

I am a 30 year old single mother of one child (6 years old). Four years ago, my cousin and I agreed to rent and share a house together. We split all the household expenses 50-50. Two and half months ago, she got married and her new husband moved in. We all agreed that each of us would then pay a third of the household expenses. This way, we could all save and then they and I could move apart from each other after 6 months to a year.

Last night, my cousin told me that her husband quit his job because he didn't have transportation and that she was demoted at her job and took a pay cut. She asked if the two of us could go back to paying 50-50. I told her that the employment situation for them is unfortunate, but it should have nothing to do with me. Since we are three able-bodied adults, we each should have a share. And since they are married, they are obligated to carry each other's load if one falls short. I told her that I don't think I should be responsible. Also, paying more expenses would delay my savings and eventually moving on my own, which is what I want to do. If I was in a financial situation to pay half, I would do it. I have way more expenses than they do (child care, car note, insurance, school loans, etc.). She said to forget it and now there's tension and I feel badly for turning them down. I've decided to move in the next few weeks, savings or no savings.

They believe that since they are married and are "one", that they should only pay half. I believe it makes no difference. If they were not married, he would have to move out if he couldn't pay. But since they are married then he's entitled to live there. And if he can't pay then she, and not I, has to pay for him. Do you think I am being unreasonable? I feel caught up and trapped. If they don't find a cheaper place before I move, they will be left with all the expenses and no furniture. Staying for the agreed-upon six months to a year now seems like forever. How can I get out of this without causing further tension?

DHS

Dear DHS,

Your living arrangement of sharing a third of the rent and household expenses was something negotiated and agreed upon so you certainly have a valid argument for declining your cousin's request to go back to 50-50. However, you have a relationship with these individuals that also has to be taken into account. You have to consider the issue of friendship as well as your own self interest. Are you willing to lose a good relationship with your cousin because of this situation?

Another thing to consider is that there could be compromises and negotiations. Given the fact that your child also lives there may justify splitting the rent 50-50. However, the household expenses are certainly greater for two adults than one adult and one child. It might be reasonable to have them pay two thirds of the household expenses and one half of the rent. Perhaps you can negotiate some other ways that they can satisfy their obligations through  housekeeping chores or babysitting.  

This is a difficult situation DHS and there is no one right answer. All of you need to be reasonable and open minded. If the tension and animosity continues, it's not worth living together at any cost. If the friendship of your cousin and her husband mean a lot to you, try to work out something you can all live with. Please let me know what happens.

happy(moneyissuesarenevereasy)shrink

 

Happyshrink,

When my family took long car trips, I pretended to have a little man named "Jasper" in my pocket that I would throw out onto the highway.  I would watch him run alongside the car on the pavement, and before I took my eyes off the road, I'd make myself catch him and put him back in my pocket.  Eventually, I made up a girlfriend for him named "Jasperette."

Edna Hoppenstetter.

Dear Edna,

I don't want to traumatize you, but did it every occur to you that Jasper and Jasperette might have been somebody's roadkill?

happy(keepingallmyimaginaryfriendsinmypocket)shrink

 

Date: July 13, 2001

Franny replies (see her July 5, letter):

Dear happy,

Hey, it's me again, Franny. Thanks for your answer. Here are my answers to your questions: I am 13 and going into the eighth grade. I think these problems started when I was in fifth grade. All I remember about fifth grade is slowly getting really unhappy and it lasted all the way through fifth grade. I don't remember the summer well. In sixth grade I continued feeling unhappy and when my mom noticed, she transferred me to another school. That's when I suddenly became very hyper and happy and elated. I thought this was the real me and I was fine until I became unhappy again. This lasted through the second half of sixth grade and all through the summer. Then in seventh grade I was extremely happy again. I thought I was invincible so I did stupid stuff that got me into a lot of trouble. I was getting bad grades, detentions, I even got suspended once. Then I became unhappy again and I still am now. That is the history of it.

As for the odor thing and everything else, most of my family has OCD, and
that's probably what it is. My brother had it really bad a few years ago. Our doctor put him on Prozac and he's fine now. My father has Bipolar Disorder, and he's taking Prozac too.

As for my parents suspecting, there have been a few events that opened their
eyes a bit. At the beginning of my seventh grade year, I was assigned a
school journal, and i wrote a lot of things down in it. My teacher read one
page on which I wrote about being hyper and not being able to focus and so on
and she showed my parents that. They signed me up for counseling in the
school. I was supposed to be called down to the counselor's office but I
never was. I told my mother and she called the office at my school and told
them to forget it, she'd make an appointment elsewhere. So she played phone
tag with a counselor for about 2 weeks and then stopped. She never said
another word about it. My dad never mentioned it either. My parents are busy
business people, and they don't have a lot of time to do anything but their
work! They're divorced, by the way. 

So in conclusion to that, my worst fear about telling my parents is that my mom would make a huge fuss about it then shrug it off like before. My dad wouldn't care. My relationship with my mom is ok. I love her a lot but sometimes she can be unreasonable and I let her know and be get into fights. but I love her to death. I lover her so much that I have had sobbing fits just thinking about her dying. my dad is just
there. I love him to but we don't really communicate. sometimes I think he tries, but it doesn't work out well. so my relationship with my parents is good. I just cant talk to them. I try.

Nothing traumatic has ever happened to me. I am a typical person. My parents
got divorced, that sucked, but that happens to a lot of people. I got over it.
I don't really care that they're divorced and I don't think it's my fault or anything stupid like that. Uell, that's all. Thanks,

Franny

Dear Franny,

Divorce is very common these days but that doesn't mean it isn't traumatic for kids. Despite the fact that you have made some good adjustments to your parent's divorce and you don't blame yourself, doesn't mean that there aren't some real hurts that still exist as a result of it. You say you love your father but I get more of a sense of ambivalence than love. It also sounds like you have written him off as being too busy to be there for you. Despite the fact that you love your mother very much, you have trouble communicating with her and you fear she may not follow through on helping you. Your thoughts about her dying may be symbolic of your fear that she won't be there for you when you need her.....and you need her NOW.

Given the history of mood and anxiety disorders in your family, you really need to be evaluated by a psychiatrist as well as get counseling. Yes, your mother is busy and perhaps she got overwhelmed a bit when she tried to get you some counseling at the beginning of 7th grade. But I think that if you let her know how you really feel, she will come through for you. I suggest you show her your two letters to me as well as my answers. She can even write me if she needs help in getting you the treatment you need. Talk to her Franny. Don't go through 8th grade being unhappy. Life is too wonderful for that. Please let me know what your mom says.

happy(itsawonderfullife)shrink

 

Dear Happy,

The Circle K Trailer Park Olympics have begun. I wish you were here. It looks like Bubba may win another gold medal. Here he is with Earl in the finals of the "Ringers'nRimmers" event.

Bubba's the one without the hat by the way. At least you can post this picture because his fly ain't open like last year.

Edna

Dear Edna,

His fly wasn't open on his pants last year either. Actually, he wasn't wearing any pants.... or underwear.

happy(Letthegamesbegin)shrink

 

Date: July 12, 2001

Happyshrink,

What do you do with someone who has been diagnosed as a schizophrenic and refuses to take the medication to help lead a normal life. This person has been put in a mental health facility and every time they improve they will take medicine for a short period of time and eventually stop taking it. 

LM

Dear LM,

Unless this person is a danger to themselves or others, they have the right to refuse medication. Recently in New York State, the legislature enacted "Kendra's Law" which mandates for chronic mentally ill individuals with recurring hospitalizations due to violent or self destructive or inappropriate behavior to be forced to take medication and receive recommended treatment. Refusal to comply would then result in a court ordered psychiatric hospitalization. This law was enacted as a result of the tragic death of a young woman who was pushed in front of an oncoming subway train by a severely mentally ill individual. Ironically, this individual had sought hospitalization 4 times during the previous year and was sent away each time with medication, but no supervision.

What is important to remember is that the vast majority of mentally ill people are not violent or harmful to themselves. Most are compliant with medication and are able to function in society. They do have the right just as you do to accept or refuse medication. The quality of their lives as a result of their decisions is their responsibility. There are people that go through the cycle of hospitalization- treatment - release - decompensation - re-hospitalization for most of their lives. Other than trying to point out the cycle, there isn't much you can do for the person you know. If you do feel that he/she is a danger to himself or others, don't hesitate to call 911. 

happy(safetyfirst)shrink

 

Dear Happy,

When the Health Department Nurse Conni come yesterday week, I showd her a caccoon I put in a jar with some leaves to turn into butterflies like Mary got. She grows em in her trailer and them a flyin in a glass case in the corner is real purdy. But nurse Stupate sayed it were rat poop. She give me a rat trap and set it with some goverment cheeze. But the rat din't want no part a that thar cheeze. So I put a peece o chitlin in the trap an' sho nuff catched him las nite. But he was still wigglin even with the thing pinchin him at the nek an' sholders. I waited a bunch o' ours, but he jus din't die. So I picked up the trap with the wire thing that hooks ta the bait thing a hangin. I dropped it a couple times when the rat tale smacked my hand. Gross!!! So I got him outside an' put him in the rain. Ours later he was still a floppin' So I called Jewitch an' she said drown him. So I filled a bucket wit water an' threw the trap an' him inner. But the trap was wood and now he aflootin' and swimmin' fer another couple ours. He jist wont die. Kin you give me any Idees. ( Dont tell me ta ask Mary, shees from the other wing o the Republican Party an she aint never seed a rat).

Gind Rinker

Dear Gind,

You contacted all the wrong people. As soon as you caught that rat you should have called Edna. It would have been on her dinner table faster than you could say the words, "ROAD KILL!"

happy(willskipdinnertonight)shrink

 

Date: July 11, 2001

Hi Happyshrink, 

My name is Lori I'm 25 and I was diagnosed with Schizo-affective Disorder in 1998. I live in Michigan and I have been shuffled from doctor to doctor for the past three years. I need advice in how to find a doctor who will work well with me. I have a sensitivity to many anti psychotics which makes it hard for me to take the meds I need. Also I feel that I don't need the high doses of medicine that are always prescribed. I can't find a doctor who will work with me. They seem to not hear what I tell them or maybe they don't care. Sometimes I feel that doctors think they know too much to listen to what I have to say about how my drugs are making me feel. I really need help because I'm very tired of not being heard. Thanks for the time. 

Lori

Dear Lori,

Sometimes doctors don't listen as well as they should and this can limit the effectiveness of their interventions even if they have good ideas about your treatment plan. On the other hand, if you go through doctor after doctor without finding anyone who will work with you, it may indicate unrealistic expectations on your part. Keep in mind that you suffer from serious mental illness that can be treated but not cured. All anti psychotic medications have side effects and don't work the same way for everybody. The results you would like to see and the result that you can achieve may not be the same.

I do have one suggestion for you Lori. Look for a local chapter of NAMI (the National Alliance for the Mentally Ill) (Click here) You can go to their Home Page and click on their help line to find out the state and local affiliate in your area. This is a consumer based organization who will listen to your concerns and can recommend support groups and perhaps even practitioners in your area that will listen to you. You do need to have a say in your treatment Lori. Perhaps there are people in this organization that can help make your psychiatrists listen to you. Equally important is that you listen to them. Please let me know if you have any luck.

happy(goodluck)shrink

 

Dear Happyshrink,

Did you know that:

Jell-O is made of hydrolyzed collagen, which is partially decomposed protein taken from cow and pig hides, hooves, bones, and connective tissue. The protein in these animal materials is broken down with an alkaline solution and then extracted with hot water.

YUMMY !!!

JeWitch

 Dear JeWitch,

Why do you think there's always room for Jello then? Must be those delicious artificial flavors!

happy(nothingartificalhere)shrink

 

Date: July 10, 2001

Dear Happyshrink,

My friend is 68, and for 30 years has believed that the FBI has been watching his house. He also believes that, if his car breaks down, the FBI did it...he has purchased guns to defend himself... In other behavioral aspects he is OK.  Goes out to concerts, movies by himself.  He does live alone... Question:  Could he harm himself or others?

BA

Dear BA,

The belief system that the FBI, the CIA or other law enforcement agencies are after you is a common theme for people suffering from paranoid delusions. The vast majority of these individuals are harmless and non-violent. Many function in a fairly normal capacity other than their delusion.

What troubles me about your friend is that he purchased guns to defend himself. Now he has the means to commit a violent act. As someone who lives alone, is alienated and is not receiving any treatment (that's an assumption on my part) he really does sound like an accident waiting to happen. Mental illness can get worse and as his life feels more and more empty, he just might fill it with more paranoid ideations. 

I don't know if your urging him to seek help will end up just putting you on the "enemy list." I would contact local authorities and make them aware of his problems. It just may save his or someone else's life. This is a really tough situation BA. Let me know what happens.

happy(nolaughingmatter)shrink

 

Dear happy,

Please help me send my youngins to summer camp.   Let the counselors deal with the head lice this year.  All the really KOOL KIDS are sporting these new T-shirts and the Circle K is giving FREE COFFEE REFILLS with the mugs ... 

Get yours here:

OK .. I am lying about the coffee cups ..  But NOT the head lice ... 

Edna Hoppenstetter

 Dear Edna,

Normally I don't allow shameless advertising on my web page but them I thought to myself, "After all the interesting stories you have shared on my web page, it's the least I can do." I hope your kids have a fun, safe and felony free summer for a change.

happy(Ialreadyhaveateeshirt)shrink

 

Date: July 9, 2001

Dear Happy,

Having these sessions with my psychologist is really starting to bring things up I haven't thought about since I was a kid.  Guess I didn't think they were all that important at the time, but some things are really bothering me, some times I can't sleep even with a sleep aide.  Lately I can't seem to get what my grandmother said to me, out of my head.  It was a long time ago, but it is so clear.

I had been asking for my brother, I don't know why, I just wanted him.  I guess I had made her mad or something, anyway she told me that she and my mom were suppose to go back and adopt my brother, but that it was a good thing they hadn't.  She said It was hard enough dealing with me, there was no way they could handle both of us.  

I would have died if they had not adopted me when they did, my brother was in the same shape.  They never went back and got him because I was bad, because I was too much trouble. People ask me if I have ever tried to go back and find my family, I have not, I am afraid.

If my brother is dead it's because of me, I couldn't make my parents happy.   I blame myself for this, and have never believed that I should have survived.  I still don't. I didn't mean to make them so angry. No question, just a realization.

Nothing to say. I'm sorry is too late.

M

Dear M,

I'm sorry is too late. Only the person that should have been saying I'm sorry is your grandmother. What a cruel and horrible guilt trip she put you on. To have promised to adopt your brother and then tell you they wouldn't do it because of you is truly unforgivable. What did you do that was so bad. Did you wet the bed?.... Make your room messy?.... Not eat your vegetables? What high crimes were you guilty of M? You were a little girl to be honest, you weren't old enough to be that bad.  Even if your mother and grandmother may have saved your physical life, they have tormented your soul and that amounts to child abuse. You probably haven't thought of it in those terms but that's exactly what they did. Knowing your history a little bit, they were also guilty of neglect. They didn't provide for you a safe and secure environment and they didn't protect you from other members of your family.

I don't know if your brother is still alive or not, but I do know that you were a little girl and could not possibly save him. It was adults who were responsible for saving his life and if they stood by and did nothing then SHAME, SHAME on them! Your grandmother is no longer around, but you are. Save yourself now and a little bit of your brother will always survive.

happy(It'snottoolateforyou)shrink

 
 

 

Dear Happyshrink,

I wanted to add, the advice to children to "Never go with a stranger anywhere." is often inadequate. More times than not, the sexual predator is someone the child knows as a family friend or a member of his or her own family. Bad touch is still bad even when you know the person doing it!

Sincerely,

Judi(workedwithtoucheesANDtouchersatmylastjob)blueye

DearJudi,

As always, you make an excellent point. Perpetrators can be family members and friends as well as strangers. We are not talking about normal expressions of affection. We are talking about "bad touch" which is bad when anyone does it.

happy(triestoprovidegoodtouch)shrink

 

Dear Happy,

Can you believe that Martha Stewart is a friggen billionaire? What about me? My advice is just as good in fact it's even better:

Martha's way #1:
Stuff a miniature marshmallow in the bottom of a sugar cone to prevent ice cream drips.
JeWitch's way:
Just suck the ice cream out of the bottom of the cone, for Christ's sake, you are probably lying on the couch with your feet up eating it anyway.

Martha's way #2:
Use a meat baster to "squeeze" your pancake batter onto the hot griddle and you'll get perfectly shaped pancakes every time.
JeWitch's way:
Buy the precooked kind you nuke in the microwave for 30 seconds. The only hard part is getting them out of the plastic bag.

Martha's way #3:
To keep potatoes from budding, place an apple in the bag with the potatoes.
My way: JeWitch's way: Buy Hungry Jack mashed potato mix and keep it in the pantry for up to a year.

Martha's way #4:
To prevent egg shells from cracking, add a pinch of salt to the water before hard boiling.
JeWitch's way: 
Who cares if they crack, aren't you going to take the shells off anyway?

Martha's way #5:
To get the most juice out of fresh lemons, bring them to room temperature and roll them under your palm against the kitchen counter before squeezing.
JeWitch's way:
Sleep with the lemons in between the mattress and box spring.

Martha's way #6:
To easily remove burnt-on food from your skillet, simply add a drop or two of dish soap and enough water to cover bottom of pan, and bring to a boil on stove top.
JeWitch's way:
Eat at Chili's every night and avoid cooking.

Martha's way #7:
Spray your Tupperware with non stick cooking spray before pouring in tomato based sauces and there won't be any stains.
JeWitch's way:
Feed your garbage disposal and there won't be any leftovers.

Martha's way #8:
When a cake recipe calls for flouring the baking pan, use a bit of the dry cake mix instead and there won't be any white mess on the outside of the cake.
JeWitch's way:
Go to the bakery. They'll even decorate it for you.

Martha's way #9:
If you accidentally over salt a dish while it's still cooking, drop in a peeled potato and it will absorb the excess salt for an instant "fix me up"
JeWitch's way:
If you over salt a dish while you are cooking, that's too damn bad. My motto: I made it and you will eat it and I don't care how bad it tastes.

Martha's way #10:
Brush some beaten egg white over pie crust before baking to yield a beautiful glossy finish.
JeWitch's way:
The Mrs. Smith frozen pie directions do not include brushing egg whites over the crust and so I don't do it.

Martha's way #11:
Place a slice of apple in hardened brown sugar to soften it.
JeWitch's way:
Brown sugar is supposed to be "soft"?

Martha's way #12:
When boiling corn on the cob, add a pinch of sugar to help bring out the corn's natural sweetness.
JeWitch's way:
The only kind of corn I buy comes in a can.

Martha's way #13:
To determine whether an egg is fresh, immerse it in a pan of cool, salted water. If it sinks, it is fresh, but if it rises to the surface, throw it away.
JeWitch's way:
Eat, cook, or use the egg anyway. If you feel bad later, you will know it wasn't fresh.

Martha's way #14:
Cure for headaches: Take a lime, cut it in half and rub it on your forehead. The throbbing will go away.
JeWitch's way:
Martha, dear, the only reason this works is because you can't rub a lime on your forehead without getting lime juice in your eye, and then the problem isn't the headache anymore, it's because you are now blind.

Martha's way #15:
If you have a problem opening jars: Try using latex dish washing gloves. They give a non-slip grip that makes opening jars easy.
JeWitch's way:
Go ask the very handsome neighbor to do it.

Martha's way #16:
Potatoes will take food stains off your fingers.  Just slice and rub raw potato on the stains and rinse with water.
JeWitch's way:
Mashed potatoes will now be replacing the anti-bacterial soap in the handy dispenser next to my sink. NOT!

Martha's way #17:
Now look what you can do with Alka Seltzer.  Clean a toilet.  Drop in two Alka-Seltzer tablets, wait twenty minutes, brush and flush. The citric acid and effervescent action clean vitreous china.
Clean a vase. To remove a stain from the bottom of a glass vase or cruet, fill with water and drop in two Alka-Seltzer tablets.  Polish jewelry. Drop two Alka-Seltzer tablets into a glass of water and immerse the jewelry for two minutes.  Clean a thermos bottle. Fill the bottle with water, drop in
four Alka-Seltzer tablets, and let soak for an hour (or longer, if necessary). 
JeWitch's way:
Put your jewelry, vases, and thermos in the toilet. Add some Alka-Seltzer and you have solved a whole bunch of problems at once.

JeWitch

Dear JeWitch,

Martha Who?

happy(toastingupthoseEGGOwafflesaswespeak)shrink

 

Date: July 8, 2001

Dear Happyshrink,

Last week a boy in our neighborhood was arrested for sexually abusing several children on his block.  My own children were not victims of this but have 3 friends who were.  They are only 6 and 8 years old and I don't know how to explain this to them.  It is something that has affected the entire community and the parents of their friends have understandably clamped down on the freedom that their kids have as well as placing them in therapy.  My kids don't understand this though.  What's the best way for me to help them understand this?

Concerned Mom

Dear Concerned Mom,

It's unfortunate that discussions about "bad touch" only seem to happen when there is a crisis. This sort of thing happens a lot more than you might think and only a fraction of these incidents are reported. This issue should be something talked about in schools, in youth centers and at home on a regular basis. There are children's books that handle this difficult issue and teachers even have curricula on the subject. Make sure that your PTA is active in making this part of your children's education.

In a nutshell, you need to help your child understand the following:

1- Nobody has the right to touch them when they don't want to be touched.

2- If someone does this against their will, they must tell you immediately, no matter what the "toucher" says. You must promise to believe them and help them.

3- If the "toucher" threatens them, you will protect them and make sure they will be safe.

4- Unless you give them permission, they should not go in a car, a house/building or away from their "play area."

5- They should never go with a stranger no matter what the stranger tells them. 

I am sure there are a few more good rules to follow. If anyone out there has any ideas, I will be happy to post them. Continue to be concerned, Concerned Mom, but also be proactive. It will pay off in the long run.

happy(whenkidsaresafe)shrink

 

 

Dear Happy,

Ya axed me "So is Harold doing this job for free or does he get some fringe benefits?" Well, Mary sayd she was hirin' Harold. Fer mosta trailer park fokes, they'd be no question bout the pay bein' booty, but Mary an' Harold is differnt. They smiles when they smell a rose and they been smilin' a lot, but there's a lot o' roses. Give it 9 months.

Gind Rinker

Dear Gind,

Thanks for answering my question. Gee, I didn't realize they had roses in Florida. But as Mary always says, maybe it's time for all of us to wake up and smell the roses.

happy(smileswhenhesmellanoranges)shrink

 

Date: July 7, 2001

Dear Happyshrink,

Any tips for helping kids adjust to a long distance move?  We're moving from Ohio to England because of my husband's job with the Air Force.  My kids have never had to do this before and they seem to be very unhappy right now.  How can we make this easier for them?

Sensitive Mom

Dear Sensitive Mom,

Any kind of move is particularly unsettling to children. A move to another country, (even one that speaks the same language) is even more unsettling. I don't know if you can really make it easy for them but I have a couple of suggestions about what you can do to help them make a more positive adjustment. 

If your kids have good friends in Ohio, make sure that you exchange home addresses, email addresses and phone numbers with them. Your kids will feel more secure if they know they can keep in touch with good friends and even call them from time to time. There are many chat programs that can enable kids to chat on line as well. Keeping connected with people back home will ease the culture shock and also help them to stay in touch with their own "roots."

I don't know if this is possible but try to give them as much information about where they will be living, the schools they will be going to, some of the recreational activities available, etc. The more familiar they become with their future environment, the quicker they will adapt.

My final suggestion Sensitive Mom, is find out about the kids who will be living near you. See if you can help your kids to make some connections with kids their own age. Making friends is one of the big obstacles of adjusting to a  move. If you can help facilitate this process, you'll have half the battle won.

My last thought to you Sensitive Mom is for you to work through your own feelings, fears and apprehensions about this move. Sometimes we get so worried about our kids, we forget our own needs that have to be met. Think about how you can best adjust to this new situation. If you are struggling with a new life and a new culture, the kids will also struggle. Work together as a team to make this new life work for all of you. Good luck and let me know how things work out.

happy(workingthroughchangestoo)shrink

 

Dear Happy,

You should see Mary's yard. Member when I told ya bout her havin' trubble wit her mower? Well, one of Jewitch's boyfriends or husbands (she wont say) Harold, has been hired full time to make trellises an' plant beeeutiful flowers and edge the walk an' stuff. When he lived wit the Witch, he cleaned her frig an' washed the floors and cooked salmon almondeens an' brung home a terrific pay check from a night job at an 888 number talkin' ta women who coudint get none. He got the job when he tol em he coud keep an erection fer 2 hours without usin' his hands.........he says its all in the mind. Anyhow, Jewitch run him off. She said she coudn't stand one mor bowl o' vichyswoz (I maybe spelt that wrong). Mama says she is nuts ta kick out a good man like that. I agree, its hard ta find a good edger.

Gind Rinker

Dear Gind,

JeWitch's loss is Mary's gain. I bet by the time old Harold is through, Mary will have the best looking yard in all of Orlando. Actually, thinking about the lawns I've seen in Florida, Mary may already have the best looking yard in all of Orlando. So is Harold doing this job for free or does he get some fringe benefits?

happy(canbenefitfromalittlefringe)shrink

Date: July 6, 2001

Dear Happy,

Yep... it's me again. How are things with everybody? I am doing ok, except for that little problem with anxiety. The doctor has increased the Stelazine to 20mg a day and it seems to be helping except for the fact that I am perpetually tired. I guess every solution brings its own problems. I hate relying on medication to solve problems but where I am at the moment there are very few facilities for counseling and therapy unless you have insurance...which I don't. My partner also seems to think I'm taking on too much, and he may be right. Unfortunately I have an over developed sense of responsibility and I take on the world's problems. 

On the other hand worrying about where we are going to get our rent money doesn't seem so abnormal to me. The basic difference between my partner and I is that he is of the attitude that the universe will take care of us and if we just wait it out something will come along. I tend to want to make things happen instead of waiting for them to happen. I am just a little frustrated at the moment and I guess things will sort themselves out. In the meantime is it ok if I use my duvet periodically to hide from reality? I hope you all have a nice weekend.

Regards

Shez

Dear Shez,

Everyone should have what we call in America, a "security duvet" just for moments like yours. There's no harm as long as you get out from under them every once in awhile. I understand that you don't have insurance for therapy, but have you looked into support groups? There are some consumer based mental health associations that have support groups for individuals suffering from a chronic mental illness. Often these groups are free or just a nominal fee to pay for a room and refreshments. I don't know if they have these where you live but they should. Perhaps if you try and start one, you can change the world a little bit. Something to think about. You are not alone Shez and I bet you would be surprised to find out how many people are out there with a similar condition as yours. Thanks for the update and continue to keep in touch.

happy(willspendpartofhisweekendunderhisduvet)shrink

 

Dear Happyshrink,

I have a REAL FRIGGIN' PROBLEM this time ..... no matter how HARD I TRY ... I cannot stop using CAPS or these damn ...... dot dot dot's .... HELP !

JeWitch

Dear JeWitch,

I think that it might just be that time of the month for you. Perhaps that's why I got this cartoon emailed to me by your boyfriend with the message HELLLLLLP!!!!!!:

 

happy(taketwoMotrinandcallmeinthemorning)shrink

 

Date: July 5, 2001

Dear Happy,


I've tried a lot of these things, before just writing down my problems. I get
the same answer: Talk to someone. Get an appointment with a psychiatrist. But
for me, it's not that easy because I'm a kid. How am I supposed to go about
telling my parents these things. I've tried to reach out in every way. It
doesn't work. I go through periods of extreme depression, then it suddenly
changes into me being hyper, elated, over excited, overly happy. These phases
can last anywhere from 1 day to 6 months. I also have intense fears of
smelling bad, being dirty, and being embarrassed in public. I know I need
help, but how? These things are getting worse, I'm scared I'm going to break down, I can feel it coming. 

I hate group situations, probably because of my fear of being embarrassed. I put on a very strong perfume because I'm scared of smelling bad, I brush my teeth more than I need to, I'm self conscious about the way I smell all the time. Sometimes I smell my hands and I think they smell awful and I wash them all day and the smell doesn't go away. I'm pretty sure a smell so bad can't be my imagination, even though friends tell me my hands only smell like soap. Even worse is my fear of being embarrassed in public. When I'm in school, I always think people are laughing at me and since I can't see my back, I think it's something going on back there. A piece of toilet paper hanging out the back of my pants, something like that. This terrifies me. I spend all day worrying.

But worst of all, I am very depressed a lot. I experience, sudden, violent mood swings. I get extremely hyper, and I think I'm invincible, so I do really stupid stuff that gets me in trouble. I am really happy, and I feel like I need to jump up and run around. These problems are not only interfering with my life, they ARE my life. I don't want you to tell me that I need to see someone or talk to someone, I already know that much. I just want to know how I can tell my parents or someone who can help. I'm hoping you can answer my question. Thank you.

Franny

Dear Franny,

You are describing some really awful feelings and I can appreciate how scary it must be to talk to your parents or any adult about them. Even writing me must have been very hard. I wonder if there are any adults in your life that you can trust with your problems. Is there a school teacher, your family doctor or your family clergyman that you can trust? Is there another relative like an aunt or uncle you can talk to? Sometimes it is easier to talk to someone who you are not as close with about some of these issues. I know that school is out, but even making an appointment with a school counselor in the fall might be a little easier than talking to your parents. The only problem with that idea is that I would rather you not wait so long to get the help you need.

I also have some questions for you Franny that I would like you to answer for me in a follow-up letter. First I would like for you to tell me your current age and at what age  these problems began for you. Do your parents suspect that you have a problem? Have they ever commented about your mood swings or your worries about odor? What is your worst fear that might happen if you were to tell your parents about your problems? How would you describe your relationship with your mom and your dad? Did you ever have something really bad happen to you when you were younger? Answering these questions may help me to give you further advice that might help you. please email me with the answers and I will post my response on this page. Don't give up on this Franny. You can the get help you need.

happy(tryingtohelp)shrink

 

Dear Happyshrink,

Last week I went to the store and for a change decided to buy some oyster crackers.  But something bizarre has happened.  When I opened them, instead of just eating them, I found that I took all of them out of the package and lined them up.  Then I counted them.  Then I ate one.  Then I counted them again.  I was mesmerized by the whole thing.  By the time I was done, 3 1/2 hours had passed and I missed making dinner for my Gilbert.  I  apologized, but he was angry with me. It was sweet and sour meatloaf night; Gilbert's favorite.  I said that I was sorry again and again.  I was very upset and went out and bought another package of oyster crackers and did the same thing.  It has been a week now and I have done this every day.  I now have "rules" for the way the crackers have to be lined up, how I line them up and how I rearrange them after one has been eaten.  Today, I spoke briefly to one of the crackers before I ate it and said that it was a necessary sacrifice. 

I think something is wrong with me but this is way to weird to tell anyone about. I keep telling myself that I'm just going to stop, but I can't do it.  I have been completely normal until now.  What is wrong with me?

Mildred Thigpen

Dear Mildred,

I know you think you have been normal up until now, but according to your neighbor JeWitch, you have always been out of your mind so I wouldn't worry that this new behavior constitutes a major change for you. Given how much fun your husband Gilbert is, I'm surprised it took you this long to make friends with those oyster crackers. Just enjoy your new hobby. Maybe this will become an alternative to snooping on JeWitch. 

happy(thislittlecrackerwenttomarketandthislittlecrackerstayedhome...)shrink   

 

Date: July 4, 2001   Happy Independence Day

Dear Happyshrink,

My brother had been diagnosed as having OCD. He also has learning disorders. He has been receiving treatment for maybe ten years now. He has never been the best at social skills but has been pretty likeable for the most part. I am 37, the oldest in the family and only girl; he is 31, youngest, second boy. He is living on his own (in a group home) for the first time ever - he has been there for about a year now.

Over the past years my brother has seemed to become more and more self-centered. The most recent example is that our mother is having her own personal crisis and as a result is moving rather far away. My brother is upset with her because she has not responded to his "list of cons as to why I will not be able to visit her". He complained to me about her not solving his problem ("she is ignoring me!"). I said she needed to take care of her own problems right now, but reassured him that she would be back to visit us often. Because she can stay with me (he and I live in the same city), he wouldn't have to worry that he'd never get to see her again. After I said that he refused to speak to me and got out of the car without so much as a goodbye.

He seems to think that he is the most important and he has very little understanding of others' needs. This is simply the latest and most concrete example. It seems almost as if he thinks everything should be done for him. Is this a function of his learning disorders (i.e., no social skills?) or an aspect of the OCD? How should I understand this? How patient or accepting should I be with these behaviors? Should I have been more sensitive and asked open-ended questions such as "Are you worried about seeing Mum?"

Can issues such as his lack of social skills and understanding of others (if that is the issue) be addressed by therapy? (To my knowledge he is only seeing an MD for meds and does not have has not had any psychiatric / psychological intervention.)

I am looking forward to your feedback.

SS

Dear SS,

While I don't know the extent of your brother's learning disabilities as well as his OCD, the fact that he is in need of supervised living would indicate to me that these conditions are considerable. There are many factors that go into his becoming more self-centered. You have hit on a few of them, Here is my take on his situation.

As someone who has lived at home all his life with the designation of "disabled person," your brother was likely to become very dependant and needy due to the supervision and nurturing he has received. I am sure you family did their best to give him a "normalized" environment. However, I have never seen a learning or developmentally disabled person who hasn't been a little spoiled by their loved ones trying to compensate for their problems. Your mother has been there for him for 30 years and now she is not. This would be upsetting to most people in his situation. Add the issue of OCD and the need to have consistent and even ritualized order in his life. This new living situation must be adding additional stress to his condition. His developmental deficits may also limit his insight with regard to what has been going on in his life over the past year. 

Often people suffering from OCD have difficulty with empathy as they are so caught up with their own "stuff." I am sure your brothers wants you and your mother in his life, but he is also angry that things have changed. It will take time for him to get over it. You and your mother need to be patient with the process. I would try not to take his recent behavior of not talking to you or saying goodbye to heart. Allow him to have his feelings for now. They will change over time, but it will take longer than for most people.

As far as his being in therapy, I would suggest you speak with some people in the group home with regard to that issue. The therapy he would receive might not be insight oriented as he may have limits in that area, but there may be some benefit in his seeing a behavioral or cognitive therapist. Usually, group homes have either quarterly or semiannual case conferences for residents. Many places encourage families to participate in this process. Perhaps you and your mother can go to the next one scheduled and explore some strategies for enabling your brother adapt to his new and more independent life. Therapy should certainly be considered an option.

The move your family made to have your brother live in a group home has been a bold one SS. In the long run I'm sure you know that it will be good for the whole family. The process will not be easy though and the best thing that you can do is be a support system for both your mom and your brother. I wish you the best and please feel free to respond as well as update me on how things work out. 

happy(changeishardformetoo)shrink

 

Dear Happy,

Some people seem to have trouble understanding me. It's as if these idiots think I'm speaking a foreign language. So for the benefit of these losers, I have given a list of word and phrases as well as their meanings. I hope this will make my life easier and I will not have to cold cock so many people, especially my boyfriend.

JeWitch

FINE
This is the word we use at the end of any argument that we feel we are
right about but need to shut you up. NEVER use fine to describe how a woman
looks. This will cause you to have one of those arguments.

FIVE MINUTES
This is half an hour. It is equivalent to the five minutes that your
football game is going to last before you take out the trash, so I feel
that it's an even trade.

NOTHING
This means something and you should be on your toes. "Nothing" is
usually used to describe the feeling a woman has of wanting to turn you inside
out, upside down, and backwards. "Nothing" usually signifies an argument
that will last "Five Minutes" and end with the word "Fine".

GO AHEAD (with raised eyebrows)
This is a dare. One that will result in a woman getting upset over
"Nothing" and will end with the word "Fine".

GO AHEAD (normal eyebrows)
This means "I give up" or "do what you want because I don't care". You
will get a raised eyebrow "Go Ahead" in just a few minutes, followed by
"Nothing" and "Fine" and she will talk to you in about "Five Minutes"
when she cools off.

LOUD SIGH
This is not actually a word, but is still often a verbal statement very
misunderstood by men. A "Loud Sigh" means she thinks you are an idiot at
that moment and wonders why she is wasting her time standing here and
arguing with you over "Nothing".

SOFT SIGH
Again, not a word, but a verbal statement. "Soft Sighs" are one of the
few things that some men actually understand. She is content. Your best bet
is to not move or breathe and she will stay content.

OH
This word followed by any statement is trouble. Example; "Oh, let me get
that". Or, "Oh, I talked to him about what you were doing last night".
If she says "Oh" before a statement, run, do not walk, to the nearest exit.
She will tell you that she is "Fine" when she is done tossing your
clothes out the window, but do not expect her to talk to you for at least 2
days.

"Oh" as the lead to a sentence usually signifies that you are caught in a
lie. Do not try to lie more to get out of it, or you will get raised
eyebrows "Go ahead" followed by acts so unspeakable that I can't bring
myself to write about them.

THAT'S OKAY
This is one of the most dangerous statements that a woman can say to a
man. "That's Okay" means that she wants to think long and hard before
paying you retributions for what ever it is that you have done. "That's
Okay" is often used with the word "Fine" and used in conjunction with a
raised eyebrow "Go Ahead". At some point in the near future when she has
plotted and planned, you are going to be in some mighty big trouble.

PLEASE DO
This is not a statement, it is an offer. A woman is giving you the
chance to come up with whatever excuse or reason you have for doing whatever
it is that you have done. You have a fair chance to tell the truth, so be
careful and you shouldn't get a "That's Okay".

THANKS
A woman is thanking you. Do not faint, just say you're welcome.

THANKS A LOT
This is much different than "Thanks". A woman will say, "Thanks A Lot"
when she is really ticked off at you. It signifies that you have hurt
her in some callous way, and will be followed by the "Loud Sigh". Be careful
not to ask what is wrong after the "Loud Sigh", as she will only tell you
"Nothing". 
 

Dear JeWitch,

Fine. Thanks a lot!

happy(sigh)shrink

 

Date: July 3, 2001  

Dear Happyshrink,

I want to write a novel and am 16 years old.  My parents laugh at me and tell me to wait until I grow up.  They say that I could never have a book published right now.  Are they right?

Unpublished and Unhappy Author

Dear Unpublished and Unhappy Author,

Mozart was six years old when he composed "Twinkle Twinkle Little Star." I don't know if you will get published at 16 or at 60 but if you think you have something of value to write about, then go ahead and write. Don't worry about what other people think. Part of being successful in life is overcoming the negativity of others. I think it's great that you want to write a novel. Go ahead and do it "Soon to be Published Author."

happy(soontohave75Khitsonhiswebsite.)

 

Happy, 

You know that old saying ....  "YOU CAN'T TAKE IT WITH YOU (When you die)" Well... that depends on what it is. If it's your dark blue suit, you can certainly take it with you. In fact, not only can you take it with you, we can probably put some of your OTHER THINGS in your pockets.

JeWitch

Dear JeWitch,

Please feel free to take my dark blue suit with you when you die. You can have all the stuff that's in the pockets too. This includes an ace comb with several teeth missing, thirteen cents, a ticket stub from the musical "Cats" and quite a bit of lint. While you are at it, you can have my red tie with the gumbo stains on it, The Hawaiian shirt my in-laws gave me for my 33rd birthday and my army surplus shoes that weigh about 12lbs. each.

PS. and don't forget that Florida Road Kill Hot Sauce.

happy(gladtohaveyouinthewill)shrink

 

Date: July 2, 2001  

Dear Happyshrink,

How do you tell someone that you have been with for over 15 years that you can't stand looking at them any more?  That they are fat, ugly, have a terrible temper and that you want to whack them with a newspaper every time you have to look at them?  This is how I feel about my wife.  I don't just not love her any more.  I really hate her.  She has become this whiny, self-centered, fat, ugly broad who just nags me from the time I get home until the time I can escape in the mornings.  She never cleans, rarely does anything that I can tell besides sit on her fat ass in front of the tv.  She doesn't even get dressed any more.  I want out of this!  I am a professional who earns enough money for the alimony.  I want her out of my life.  How can I say this so that she doesn't try to kill herself or me?

Unhappy husband

Dear Unhappy husband,

It sounds to me like you need the advice of a lawyer more than you need the advice of a happyshrink. If all you want to do is get out of the marriage, then that is your course of action. As you said, you have the means to pay alimony and still be financially secure. I don't know how "dangerous" your wife is to herself or to you, but your lawyer can advise about that as well.

I wonder though if your hatred towards your wife isn't in some way a smoke screen to hide your own self hatred. You are in a difficult situation because you chose not to do anything about it for 15 years. The relationship didn't deteriorate all by itself. If your wife is in fact unhappy and unproductive, what is your role in that? It takes two people in a relationship. It's time to take responsibility for your own failure in this one.

Now you are asking me for an easy way out. There is no easy way out on this one. I don't know if you have children or what other things need to be considered, but right now you need to start the process of honest communication. That doesn't mean telling your wife that she's fat and ugly. It means telling her that the marriage isn't working for you. I can't guarantee you any results on this one unhappy husband. It's your move.

happy(somethingsaren'tsupposedtobeeasy)shrink

 

Dear Happy,

invited some people over for a Bar-B-Q / pool party Memorial Day. At the table, my Daughter-in-Law said to my Grandda... Niece, Would  you like to say the dinner blessing?"  (note, this is my Daughter-In-Law, not my daughter.) "I don't know what to say," Little JeWitch answered her mom. "Just say what you heard Grandma JeWitch say," my Daughter-in-Law answered.  

Little JeWitch bowed her head and said, "Lord, why on earth did I invite all these stupid people here?"

JeWitch

Dear JeWitch,

So why did you invite all those stupid people? I think I know the answer. That's the only kind of people who live in your neck of the woods.

happy(passsomeofthoseribs)shrink

 

Date: July 1, 2001  

Dear Happyshrink,

I will be attending a family reunion with more family members than I have ever seen (Some of them I have never before met). I am looking forward to going up north to the old family farm, escaping the heat, and hitting the beach on Grand Traverse Bay. However, the thought of all those relatives in one place is making me anxious! I opted to drive myself, rather than riding with mom and dad so I would have an escape vehicle available. Do you have any helpful stress management techniques to suggest?

Sincerely,

Judiblueye

PS the girls are on their annual "Parenting Time" with their dad, so they won't be coming with me.

Dear Judi,

Seeing relatives either for the first time or perhaps after a long time can be a bit unsettling. I agree with your plan to drive up by yourself just in case. My suggestion though, is to set out to have a great time no matter what. That means not allowing rude or thoughtless relatives to insult you or make you unhappy. You choose your friends; you don't choose your relatives. They are who they are. Enjoy the good ones and ignore the a**holes. It will be nice to be away from the kids for awhile and be able to indulge yourself. You deserve it Judi. Enjoy the time away and be sure to give me a "blow by blow description of your wild and wacky family adventure.

happy(hassomewildandwackyfamilygatheringstoattendthissummer)shrink 

 

I will NEVER be happy again .. REALLY REALLY HAPPY and SATISFIED without cigarettes ... Just thought I would drop you a note and tell you I am feeling F***ING FINE !!

JeWitch

Dear JeWitch,

Let's get real. Life was hell even with cigarettes. So it's still hell. What did you expect... Disney World?  So sue me. Like I care.

happy(feelingabitWichielately)shrink

 


Back to "Ask Happyshrink" Home Page Back to most current postings